Lineage for d1z06a1 (1z06 A:32-196)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867361Protein Rab-33b [142279] (1 species)
  7. 2867362Species Mouse (Mus musculus) [TaxId:10090] [142280] (2 PDB entries)
    Uniprot O35963 32-196
  8. 2867363Domain d1z06a1: 1z06 A:32-196 [124301]
    complexed with gnp, mg

Details for d1z06a1

PDB Entry: 1z06 (more details), 1.81 Å

PDB Description: GppNHp-Bound Rab33 GTPase
PDB Compounds: (A:) Ras-related protein Rab-33B

SCOPe Domain Sequences for d1z06a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}
rifkiivigdsnvgktcltyrfcagrfpdrteatigvdfreravdidgerikiqlwdtag
qerfrksmvqhyyrnvhavvfvydmtnmasfhslpawieeckqhllandiprilvgnkcd
lrsaiqvptdlaqkfadthsmplfetsaknpndndhveaifmtla

SCOPe Domain Coordinates for d1z06a1:

Click to download the PDB-style file with coordinates for d1z06a1.
(The format of our PDB-style files is described here.)

Timeline for d1z06a1: