Lineage for d1z05a2 (1z05 A:209-405)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701817Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 701856Protein Transcriptional regulator VC2007 [142479] (1 species)
  7. 701857Species Vibrio cholerae [TaxId:666] [142480] (1 PDB entry)
  8. 701858Domain d1z05a2: 1z05 A:209-405 [124299]
    Other proteins in same PDB: d1z05a1
    complexed with bme, gol, so4, zn

Details for d1z05a2

PDB Entry: 1z05 (more details), 2 Å

PDB Description: crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein.
PDB Compounds: (A:) transcriptional regulator, ROK family

SCOP Domain Sequences for d1z05a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z05a2 c.55.1.10 (A:209-405) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]}
dvdnsvlisihhglgagivldgrvlqgrhgnigelghiqidpqgkrchcgnygcletvas
sqairdqvtariqagepsclatveeisiedicaaaadgdplavdviqqlgrylgaaiaiv
inlfnpekiliggvinqaksilypsieqcireqslpvyhqdlklvesrfykqatmpgaal
ikqalydglllmkvveg

SCOP Domain Coordinates for d1z05a2:

Click to download the PDB-style file with coordinates for d1z05a2.
(The format of our PDB-style files is described here.)

Timeline for d1z05a2: