SCOPe 2.08: Domain d1z05a2: 1z05 A:209-405

Lineage for d1z05a2 (1z05 A:209-405)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.10: ROK [110636] (8 proteins)
   Pfam PF00480

6. Protein Transcriptional regulator VC2007 [142479] (1 species)

7. Species Vibrio cholerae [TaxId:666] [142480] (1 PDB entry)
   Uniprot Q9KQJ1 209-405! Uniprot Q9KQJ1 81-208

8. Domain d1z05a2: 1z05 A:209-405 [124299]
   Other proteins in same PDB: d1z05a1
   complexed with bme, gol, so4, zn

Details for d1z05a2

PDB Entry: 1z05, 2 Å

PDB Description: crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein.

PDB Compounds: (A:) transcriptional regulator, ROK family

SCOPe Domain Sequences for d1z05a2:

Sequence; same for both SEQRES and ATOM records:

>d1z05a2 c.55.1.10 (A:209-405) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]}
dvdnsvlisihhglgagivldgrvlqgrhgnigelghiqidpqgkrchcgnygcletvas
sqairdqvtariqagepsclatveeisiedicaaaadgdplavdviqqlgrylgaaiaiv
inlfnpekiliggvinqaksilypsieqcireqslpvyhqdlklvesrfykqatmpgaal
ikqalydglllmkvveg

Timeline for d1z05a2:

• d1z05a2 first appeared in SCOP 1.73
  
• d1z05a2 appears in SCOPe 2.07