Lineage for d1z05a2 (1z05 A:209-405)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2461957Family c.55.1.10: ROK [110636] (8 protein domains)
    Pfam PF00480
  6. 2462006Protein Transcriptional regulator VC2007 [142479] (1 species)
  7. 2462007Species Vibrio cholerae [TaxId:666] [142480] (1 PDB entry)
    Uniprot Q9KQJ1 209-405! Uniprot Q9KQJ1 81-208
  8. 2462008Domain d1z05a2: 1z05 A:209-405 [124299]
    Other proteins in same PDB: d1z05a1
    complexed with bme, gol, so4, zn

Details for d1z05a2

PDB Entry: 1z05 (more details), 2 Å

PDB Description: crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein.
PDB Compounds: (A:) transcriptional regulator, ROK family

SCOPe Domain Sequences for d1z05a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z05a2 c.55.1.10 (A:209-405) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]}
dvdnsvlisihhglgagivldgrvlqgrhgnigelghiqidpqgkrchcgnygcletvas
sqairdqvtariqagepsclatveeisiedicaaaadgdplavdviqqlgrylgaaiaiv
inlfnpekiliggvinqaksilypsieqcireqslpvyhqdlklvesrfykqatmpgaal
ikqalydglllmkvveg

SCOPe Domain Coordinates for d1z05a2:

Click to download the PDB-style file with coordinates for d1z05a2.
(The format of our PDB-style files is described here.)

Timeline for d1z05a2: