SCOP 1.73: Domain d1z01a2: 1z01 A:164-442

Lineage for d1z01a2 (1z01 A:164-442)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (7 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO [143823] (1 species)

7. Species Pseudomonas putida [TaxId:303] [143824] (1 PDB entry)

8. Domain d1z01a2: 1z01 A:164-442 [124297]
   Other proteins in same PDB: d1z01a1
   complexed with fe, fes

Details for d1z01a2

PDB Entry: 1z01, 1.8 Å

PDB Description: 2-oxoquinoline 8-monooxygenase component: active site modulation by rieske-[2fe-2s] center oxidation/reduction

PDB Compounds: (A:) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component

SCOP Domain Sequences for d1z01a2:

Sequence; same for both SEQRES and ATOM records:

>d1z01a2 d.129.3.3 (A:164-442) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]}
plahdlpfrfperseqfphplwpsspsvlddnavvhgmhrtgfgnwriacengfdnahil
vhkdntivhamdwvlplgllptsddciavvedddgpkgmmqwlftdkwapvlenqelglk
veglkgrhyrtsvvlpgvlmvenwpeehvvqyewyvpitddtheyweilvrvcptdedrk
kfqyrydhmykplclhgfndsdlyareamqnfyydgtgwddeqlvatdispitwrklasr
wnrgiakpgrgvagavkdtslifkqtadgkrpgykveqi

Timeline for d1z01a2:

• d1z01a2 is new in SCOP 1.73
  
• d1z01a2 appears in SCOP 1.75
  
• d1z01a2 appears in the current release, SCOPe 2.08