SCOPe 2.07: Domain d1yzyb_: 1yzy B:

Lineage for d1yzyb_ (1yzy B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.146: YgbK-like [142763] (1 superfamily)
   consists of two domains with partial topological similarity to the P-loop kinases but without the P-loop motif; the domain association results in the formation of a single mixed beta-sheet of 15 strands

4. Superfamily c.146.1: YgbK-like [142764] (2 families)

5. Family c.146.1.1: YgbK-like [142765] (2 proteins)
   Pfam PF07005; DUF1537; the B-fam model-covered region is non-compact in structure and distributed between the two domains

6. Protein Hypothetical protein HI1011 [142766] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [142767] (1 PDB entry)
   Uniprot P44093 2-413

8. Domain d1yzyb_: 1yzy B: [124293]
   automated match to d1yzya1

Details for d1yzyb_

PDB Entry: 1yzy, 2.1 Å

PDB Description: crystal structure of haemophilus influenzae protein hi1011, pfam duf1537

PDB Compounds: (B:) Hypothetical protein HI1011

SCOPe Domain Sequences for d1yzyb_:

Sequence; same for both SEQRES and ATOM records:

>d1yzyb_ c.146.1.1 (B:) Hypothetical protein HI1011 {Haemophilus influenzae [TaxId: 727]}
lgviaddftgasdiasflvenglstvqmngvptqslnskvdaivislksrsnpvneaieq
slrayqwlkengctqfyfkycstfdstakgnigpvtdalldelnedftvitpalpvngrt
ifngylfvgdvllsesgmknhpitpmvdanlmrlmdaqakgktglvayadvikgasrvqe
cfaelkaqgyryavvdavdnsqlevlaeavadfklvtggsglgaymaarlsggkkgtnaf
tptkgktvvlsgscsvmtnkqvekyrekaphfqldveqaihnenyieqlyqwvianldse
fapmvyatvppdalkaiqhqfgvdqashaientfaklaaklkqygvtnfitaggetssiv
vqelgftgfhigkqiapgvpwlkaveediflalksgnfgkedffeyaqgmfl

Timeline for d1yzyb_:

• d1yzyb_ first appeared in SCOP 1.73, called d1yzyb1
  
• d1yzyb_ appears in SCOPe 2.06
  
• d1yzyb_ appears in the current release, SCOPe 2.08