Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.146: YgbK-like [142763] (1 superfamily) consists of two domains with partial topological similarity to the P-loop kinases but without the P-loop motif; the domain association results in the formation of a single mixed beta-sheet of 15 strands |
Superfamily c.146.1: YgbK-like [142764] (2 families) |
Family c.146.1.1: YgbK-like [142765] (2 proteins) Pfam PF07005; DUF1537; the B-fam model-covered region is non-compact in structure and distributed between the two domains |
Protein Hypothetical protein HI1011 [142766] (1 species) |
Species Haemophilus influenzae [TaxId:727] [142767] (1 PDB entry) Uniprot P44093 2-413 |
Domain d1yzya1: 1yzy A:1-412 [124292] |
PDB Entry: 1yzy (more details), 2.1 Å
SCOPe Domain Sequences for d1yzya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzya1 c.146.1.1 (A:1-412) Hypothetical protein HI1011 {Haemophilus influenzae [TaxId: 727]} lgviaddftgasdiasflvenglstvqmngvptqslnskvdaivislksrsnpvneaieq slrayqwlkengctqfyfkycstfdstakgnigpvtdalldelnedftvitpalpvngrt ifngylfvgdvllsesgmknhpitpmvdanlmrlmdaqakgktglvayadvikgasrvqe cfaelkaqgyryavvdavdnsqlevlaeavadfklvtggsglgaymaarlsggkkgtnaf tptkgktvvlsgscsvmtnkqvekyrekaphfqldveqaihnenyieqlyqwvianldse fapmvyatvppdalkaiqhqfgvdqashaientfaklaaklkqygvtnfitaggetssiv vqelgftgfhigkqiapgvpwlkaveediflalksgnfgkedffeyaqgmfl
Timeline for d1yzya1: