| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries) |
| Domain d1yzub_: 1yzu B: [124291] automated match to d1r2qa_ complexed with gnp, mg |
PDB Entry: 1yzu (more details), 2.5 Å
SCOPe Domain Sequences for d1yzub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzub_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiwdta
gqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidl
ekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmi
Timeline for d1yzub_: