Lineage for d1yzta1 (1yzt A:17-183)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846507Protein Rab21 [142285] (1 species)
  7. 1846508Species Human (Homo sapiens) [TaxId:9606] [142286] (3 PDB entries)
    Uniprot Q9UL25 16-182
  8. 1846510Domain d1yzta1: 1yzt A:17-183 [124288]
    Other proteins in same PDB: d1yztb_
    complexed with gnp, mg

Details for d1yzta1

PDB Entry: 1yzt (more details), 2.05 Å

PDB Description: GppNHp-Bound Rab21 GTPase at 2.05 A Resolution
PDB Compounds: (A:) Ras-related protein Rab-21

SCOPe Domain Sequences for d1yzta1:

Sequence, based on SEQRES records: (download)

>d1yzta1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}
aysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiwdta
gqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidl
ekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet

Sequence, based on observed residues (ATOM records): (download)

>d1yzta1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}
aysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiwdta
grdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidlekerhvsiqeae
syaesvgakhyhtsakqnkgieelfldlckrmiet

SCOPe Domain Coordinates for d1yzta1:

Click to download the PDB-style file with coordinates for d1yzta1.
(The format of our PDB-style files is described here.)

Timeline for d1yzta1: