Lineage for d1yzqa1 (1yzq A:14-177)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867479Protein Rab6 [52605] (2 species)
  7. 2867480Species Human (Homo sapiens) [TaxId:9606] [142216] (1 PDB entry)
    Uniprot P20340 13-176
  8. 2867481Domain d1yzqa1: 1yzq A:14-177 [124286]
    complexed with gnp, mg

Details for d1yzqa1

PDB Entry: 1yzq (more details), 1.78 Å

PDB Description: GppNHp-Bound Rab6 GTPase
PDB Compounds: (A:) small GTP binding protein RAB6 isoform

SCOPe Domain Sequences for d1yzqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]}
fklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtirlqlwdtagqe
rfrslipsyirdsaaavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdladk
rqvsieegerkakelnvmfietsakagynvkqlfrrvaaalpgm

SCOPe Domain Coordinates for d1yzqa1:

Click to download the PDB-style file with coordinates for d1yzqa1.
(The format of our PDB-style files is described here.)

Timeline for d1yzqa1: