Lineage for d1yzna1 (1yzn A:4-169)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164123Protein Rab11a [102362] (2 species)
  7. 1164124Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159558] (2 PDB entries)
  8. 1164125Domain d1yzna1: 1yzn A:4-169 [124284]
    automatically matched to d1oiva_
    complexed with gnp, mg

Details for d1yzna1

PDB Entry: 1yzn (more details), 2.06 Å

PDB Description: GppNHp-Bound Ypt1p GTPase
PDB Compounds: (A:) GTP-binding protein YPT1

SCOPe Domain Sequences for d1yzna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yzna1 c.37.1.8 (A:4-169) Rab11a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiwd
tagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnkc
dlkdkrvveydvakefadankmpfletsaldstnvedafltmarqi

SCOPe Domain Coordinates for d1yzna1:

Click to download the PDB-style file with coordinates for d1yzna1.
(The format of our PDB-style files is described here.)

Timeline for d1yzna1: