Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab11a [102362] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159558] (2 PDB entries) |
Domain d1yzna1: 1yzn A:4-169 [124284] automatically matched to d1oiva_ complexed with gnp, mg |
PDB Entry: 1yzn (more details), 2.06 Å
SCOPe Domain Sequences for d1yzna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzna1 c.37.1.8 (A:4-169) Rab11a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiwd tagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnkc dlkdkrvveydvakefadankmpfletsaldstnvedafltmarqi
Timeline for d1yzna1: