SCOP 1.73: Domain d1yzna1: 1yzn A:4-169

Lineage for d1yzna1 (1yzn A:4-169)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab11a [102362] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102363] (9 PDB entries)

8. Domain d1yzna1: 1yzn A:4-169 [124284]
   automatically matched to d1oiva_
   complexed with gnp, mg

Details for d1yzna1

PDB Entry: 1yzn, 2.06 Å

PDB Description: GppNHp-Bound Ypt1p GTPase

PDB Compounds: (A:) GTP-binding protein YPT1

SCOP Domain Sequences for d1yzna1:

Sequence; same for both SEQRES and ATOM records:

>d1yzna1 c.37.1.8 (A:4-169) Rab11a {Human (Homo sapiens) [TaxId: 9606]}
eydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiwd
tagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnkc
dlkdkrvveydvakefadankmpfletsaldstnvedafltmarqi

Timeline for d1yzna1:

• d1yzna1 is new in SCOP 1.73
  
• d1yzna1 appears in SCOP 1.75
  
• d1yzna1 appears in the current release, SCOPe 2.08, called d1yzna2