![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab11a [102362] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159558] (2 PDB entries) |
![]() | Domain d1yzna2: 1yzn A:3-172 [124284] Other proteins in same PDB: d1yzna3 automated match to d2d7ca_ complexed with gnp, mg |
PDB Entry: 1yzn (more details), 2.06 Å
SCOPe Domain Sequences for d1yzna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzna2 c.37.1.8 (A:3-172) Rab11a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} seydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiw dtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnk cdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikes
Timeline for d1yzna2: