Lineage for d1yzna2 (1yzn A:3-172)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867378Protein Rab11a [102362] (2 species)
  7. 2867379Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159558] (2 PDB entries)
  8. 2867380Domain d1yzna2: 1yzn A:3-172 [124284]
    Other proteins in same PDB: d1yzna3
    automated match to d2d7ca_
    complexed with gnp, mg

Details for d1yzna2

PDB Entry: 1yzn (more details), 2.06 Å

PDB Description: GppNHp-Bound Ypt1p GTPase
PDB Compounds: (A:) GTP-binding protein YPT1

SCOPe Domain Sequences for d1yzna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yzna2 c.37.1.8 (A:3-172) Rab11a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiw
dtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnk
cdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikes

SCOPe Domain Coordinates for d1yzna2:

Click to download the PDB-style file with coordinates for d1yzna2.
(The format of our PDB-style files is described here.)

Timeline for d1yzna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yzna3