Lineage for d1yzma1 (1yzm A:458-501)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
2 helices; antiparallel hairpin, left-handed twist
Superfamily a.2.19: Rabenosyn-5 Rab-binding domain-like [140125] (1 family) 
Family a.2.19.1: Rabenosyn-5 Rab-binding domain-like [140126] (2 proteins) Protein FYVE finger-containing Rab5 effector protein rabenosyn-5 [140127] (1 species) Species Human (Homo sapiens) [TaxId:9606] [140128] (3 PDB entries)
Uniprot Q9H1K0 441-501! Uniprot Q9H1K0 456-501! Uniprot Q9H1K0 734-784
Domain d1yzma1: 1yzm A:458-501 [124283]
Other proteins in same PDB: d1yzma2
1st Rab-binding domain
Details for d1yzma1
PDB Entry: 1yzm (more details), 1.5 Å
PDB Description: structure of rabenosyn (458-503), rab4 binding domain
PDB Compounds: (A:) FYVE-finger-containing Rab5 effector protein rabenosyn-5SCOPe Domain Sequences for d1yzma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzma1 a.2.19.1 (A:458-501) FYVE finger-containing Rab5 effector protein rabenosyn-5 {Human (Homo sapiens) [TaxId: 9606]}
pllqqihnitsfirqakaagrmdevrtlqenlrqlqdeydqqqt
SCOPe Domain Coordinates for d1yzma1:
Click to download the PDB-style file with coordinates for d1yzma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yzma1:
- d1yzma1 first appeared in SCOP 1.73
- d1yzma1 appears in SCOPe 2.07
View in 3D
