| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Rab9a [110537] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [142229] (2 PDB entries) Uniprot Q9R0M6 4-175 |
| Domain d1yzla1: 1yzl A:4-175 [124282] complexed with gnp, mg |
PDB Entry: 1yzl (more details), 1.85 Å
SCOPe Domain Sequences for d1yzla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzla1 c.37.1.8 (A:4-175) Rab9a {Mouse (Mus musculus) [TaxId: 10090]}
ksslfkiillgdggvgksslmnryvtnkfdsqlfhtigveflnkdlevdghfvtmqiwdt
agqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilg
nktdikerqvsteeaqawckdngdypyfetsakdstnvaaafeeavrrilat
Timeline for d1yzla1: