Lineage for d1yzka1 (1yzk A:8-173)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830394Protein Rab11a [102362] (2 species)
  7. 830395Species Human (Homo sapiens) [TaxId:9606] [102363] (9 PDB entries)
  8. 830402Domain d1yzka1: 1yzk A:8-173 [124281]
    automatically matched to d1oiva_
    complexed with gnp, mg

Details for d1yzka1

PDB Entry: 1yzk (more details), 2 Å

PDB Description: gppnhp bound rab11 gtpase
PDB Compounds: (A:) Ras-related protein Rab-11A

SCOP Domain Sequences for d1yzka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yzka1 c.37.1.8 (A:8-173) Rab11a {Human (Homo sapiens) [TaxId: 9606]}
ydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
agqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknglsfietsaldstnveaafqtilteiy

SCOP Domain Coordinates for d1yzka1:

Click to download the PDB-style file with coordinates for d1yzka1.
(The format of our PDB-style files is described here.)

Timeline for d1yzka1: