Lineage for d1yzka_ (1yzk A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448880Protein automated matches [190047] (29 species)
    not a true protein
  7. 2448966Species Human (Homo sapiens) [TaxId:9606] [186768] (178 PDB entries)
  8. 2449043Domain d1yzka_: 1yzk A: [124281]
    automated match to d1oiva_
    complexed with gnp, mg

Details for d1yzka_

PDB Entry: 1yzk (more details), 2 Å

PDB Description: gppnhp bound rab11 gtpase
PDB Compounds: (A:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d1yzka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yzka_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
agqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri

SCOPe Domain Coordinates for d1yzka_:

Click to download the PDB-style file with coordinates for d1yzka_.
(The format of our PDB-style files is described here.)

Timeline for d1yzka_: