SCOPe 2.06: Domain d1yzha1: 1yzh A:8-211

Lineage for d1yzha1 (1yzh A:8-211)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.53: TrmB-like [142647] (1 protein)
   Pfam PF02390

6. Protein tRNA (guanine-N(7)-)-methyltransferase TrmB [142648] (2 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142649] (1 PDB entry)
   Uniprot P67506 8-211

8. Domain d1yzha1: 1yzh A:8-211 [124277]
   complexed with gol

Details for d1yzha1

PDB Entry: 1yzh, 2.02 Å

PDB Description: Crystal Structure of the Conserved Hypothetical Protein, Methyltransferase from Streptococcus pneumoniae TIGR4

PDB Compounds: (A:) tRNA (guanine-N(7)-)-methyltransferase

SCOPe Domain Sequences for d1yzha1:

Sequence; same for both SEQRES and ATOM records:

>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gatelleanpqyvvlnpleakakwrdlfgndnpihvevgsgkgafvsgmakqnpdinyig
idiqksvlsyaldkvlevgvpnikllwvdgsdltdyfedgeidrlylnfsdpwpkkrhek
rrltyktfldtfkrilpengeihfktdnrglfeyslvsfsqygmklngvwldlhasdfeg
nvmteyeqkfsnkgqviyrveaef

Timeline for d1yzha1:

• d1yzha1 first appeared in SCOP 1.73
  
• d1yzha1 appears in SCOPe 2.05
  
• d1yzha1 appears in SCOPe 2.07
  
• d1yzha1 appears in the current release, SCOPe 2.08