Lineage for d1yzga1 (1yzg A:6-173)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124193Protein ADP-ribosylation factor [52614] (16 species)
  7. 2124250Species Human (Homo sapiens), ARL5B [TaxId:9606] [142221] (1 PDB entry)
    Uniprot Q96KC2 6-173
  8. 2124251Domain d1yzga1: 1yzg A:6-173 [124276]
    complexed with gdp

Details for d1yzga1

PDB Entry: 1yzg (more details), 2 Å

PDB Description: structure of human adp-ribosylation factor-like 8
PDB Compounds: (A:) ADP-ribosylation factor-like 8

SCOPe Domain Sequences for d1yzga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yzga1 c.37.1.8 (A:6-173) ADP-ribosylation factor {Human (Homo sapiens), ARL5B [TaxId: 9606]}
aklwslfcnqehkviivgldnagkttilyqflmnevvhtsptigsnveeivvknthflmw
diggqeslrsswntyysntefiilvvdsidrerlaitkeelyrmlahedlrkaavlifan
kqdmkgcmtaaeiskyltlssikdhpwhiqsccaltgeglcqglewmt

SCOPe Domain Coordinates for d1yzga1:

Click to download the PDB-style file with coordinates for d1yzga1.
(The format of our PDB-style files is described here.)

Timeline for d1yzga1: