| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein ADP-ribosylation factor [52614] (14 species) |
| Species Human (Homo sapiens), ARL5B [TaxId:9606] [142221] (1 PDB entry) Uniprot Q96KC2 6-173 |
| Domain d1yzga1: 1yzg A:6-173 [124276] complexed with gdp |
PDB Entry: 1yzg (more details), 2 Å
SCOP Domain Sequences for d1yzga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzga1 c.37.1.8 (A:6-173) ADP-ribosylation factor {Human (Homo sapiens), ARL5B [TaxId: 9606]}
aklwslfcnqehkviivgldnagkttilyqflmnevvhtsptigsnveeivvknthflmw
diggqeslrsswntyysntefiilvvdsidrerlaitkeelyrmlahedlrkaavlifan
kqdmkgcmtaaeiskyltlssikdhpwhiqsccaltgeglcqglewmt
Timeline for d1yzga1: