Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (7 families) |
Family c.23.10.5: TAP-like [89594] (2 proteins) |
Protein Lipase/acylhydrolase [142056] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [142057] (1 PDB entry) |
Domain d1yzfa1: 1yzf A:1-195 [124275] |
PDB Entry: 1yzf (more details), 1.9 Å
SCOP Domain Sequences for d1yzfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzfa1 c.23.10.5 (A:1-195) Lipase/acylhydrolase {Enterococcus faecalis [TaxId: 1351]} mrkivlfgdsitagyldeavspvlvdlvkrdiaamgleevavinagmpgdttedglkrln kevliekpdevviffgandasldrnitvatfrenletmiheigsekvilitppyadsgrr perpqtrikelvkvaqevgaahnlpvidlykamtvypgtdeflqadglhfsqvgyellga livreikgrlkpkqa
Timeline for d1yzfa1: