Lineage for d1yzfa1 (1yzf A:1-195)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692305Superfamily c.23.10: SGNH hydrolase [52266] (7 families) (S)
  5. 692347Family c.23.10.5: TAP-like [89594] (2 proteins)
  6. 692348Protein Lipase/acylhydrolase [142056] (1 species)
  7. 692349Species Enterococcus faecalis [TaxId:1351] [142057] (1 PDB entry)
  8. 692350Domain d1yzfa1: 1yzf A:1-195 [124275]

Details for d1yzfa1

PDB Entry: 1yzf (more details), 1.9 Å

PDB Description: Crystal structure of the lipase/acylhydrolase from Enterococcus faecalis
PDB Compounds: (A:) lipase/acylhydrolase

SCOP Domain Sequences for d1yzfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yzfa1 c.23.10.5 (A:1-195) Lipase/acylhydrolase {Enterococcus faecalis [TaxId: 1351]}
mrkivlfgdsitagyldeavspvlvdlvkrdiaamgleevavinagmpgdttedglkrln
kevliekpdevviffgandasldrnitvatfrenletmiheigsekvilitppyadsgrr
perpqtrikelvkvaqevgaahnlpvidlykamtvypgtdeflqadglhfsqvgyellga
livreikgrlkpkqa

SCOP Domain Coordinates for d1yzfa1:

Click to download the PDB-style file with coordinates for d1yzfa1.
(The format of our PDB-style files is described here.)

Timeline for d1yzfa1: