SCOP 1.73: Domain d1yz9b2: 1yz9 B:151-220

Lineage for d1yz9b2 (1yz9 B:151-220)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
   Pfam PF00035

6. Protein RNase III, C-terminal domain [54776] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [102927] (6 PDB entries)

8. Domain d1yz9b2: 1yz9 B:151-220 [124274]
   Other proteins in same PDB: d1yz9a1, d1yz9b1
   automatically matched to d1rc7a2
   complexed with so4; mutant

Details for d1yz9b2

PDB Entry: 1yz9, 2.1 Å

PDB Description: crystal structure of rnase iii mutant e110q from aquifex aeolicus complexed with double stranded rna at 2.1-angstrom resolution

PDB Compounds: (B:) Ribonuclease III

SCOP Domain Sequences for d1yz9b2:

Sequence; same for both SEQRES and ATOM records:

>d1yz9b2 d.50.1.1 (B:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

Timeline for d1yz9b2:

• d1yz9b2 is new in SCOP 1.73
  
• d1yz9b2 appears in SCOP 1.75
  
• d1yz9b2 appears in the current release, SCOPe 2.08