Lineage for d1yz9b1 (1yz9 B:3-150)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017406Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2017407Superfamily a.149.1: RNase III domain-like [69065] (3 families) (S)
  5. 2017408Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam PF00636
  6. 2017412Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 2017413Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)
  8. 2017420Domain d1yz9b1: 1yz9 B:3-150 [124273]
    Other proteins in same PDB: d1yz9a2, d1yz9b2
    automated match to d1rc7a1
    protein/RNA complex; complexed with so4; mutant

Details for d1yz9b1

PDB Entry: 1yz9 (more details), 2.1 Å

PDB Description: crystal structure of rnase iii mutant e110q from aquifex aeolicus complexed with double stranded rna at 2.1-angstrom resolution
PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d1yz9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yz9b1 a.149.1.1 (B:3-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
mleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspnk
regflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfqalwaavyidsgr
danftrelfyklfkedilsaikegrvkk

SCOPe Domain Coordinates for d1yz9b1:

Click to download the PDB-style file with coordinates for d1yz9b1.
(The format of our PDB-style files is described here.)

Timeline for d1yz9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yz9b2