Lineage for d1yz9a2 (1yz9 A:151-220)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648324Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1648325Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 1648326Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 1648353Protein RNase III, C-terminal domain [54776] (3 species)
  7. 1648354Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries)
  8. 1648360Domain d1yz9a2: 1yz9 A:151-220 [124272]
    Other proteins in same PDB: d1yz9a1, d1yz9b1
    automated match to d2nugb2
    protein/RNA complex; complexed with so4; mutant

Details for d1yz9a2

PDB Entry: 1yz9 (more details), 2.1 Å

PDB Description: crystal structure of rnase iii mutant e110q from aquifex aeolicus complexed with double stranded rna at 2.1-angstrom resolution
PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d1yz9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yz9a2 d.50.1.1 (A:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

SCOPe Domain Coordinates for d1yz9a2:

Click to download the PDB-style file with coordinates for d1yz9a2.
(The format of our PDB-style files is described here.)

Timeline for d1yz9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yz9a1