SCOPe 2.04: Domain d1yz9a1: 1yz9 A:1-150

Lineage for d1yz9a1 (1yz9 A:1-150)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.149: RNase III domain-like [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III domain-like [69065] (2 families)

5. Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
   Pfam PF00636

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)

8. Domain d1yz9a1: 1yz9 A:1-150 [124271]
   Other proteins in same PDB: d1yz9a2, d1yz9b2
   automated match to d1rc7a1
   protein/RNA complex; complexed with so4; mutant

Details for d1yz9a1

PDB Entry: 1yz9, 2.1 Å

PDB Description: crystal structure of rnase iii mutant e110q from aquifex aeolicus complexed with double stranded rna at 2.1-angstrom resolution

PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d1yz9a1:

Sequence; same for both SEQRES and ATOM records:

>d1yz9a1 a.149.1.1 (A:1-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfqalwaavyids
grdanftrelfyklfkedilsaikegrvkk

Timeline for d1yz9a1:

• d1yz9a1 first appeared in SCOP 1.73
  
• d1yz9a1 appears in SCOPe 2.03
  
• d1yz9a1 appears in SCOPe 2.05
  
• d1yz9a1 appears in the current release, SCOPe 2.08