Lineage for d1yz1d_ (1yz1 D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964913Fold b.88: Mss4-like [51315] (1 superfamily)
    complex fold made of several coiled beta-sheets
  4. 964914Superfamily b.88.1: Mss4-like [51316] (4 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 964924Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
    contains an insertion of alpha helical hairpin; lacks zinc-binding site
  6. 964937Protein automated matches [190167] (2 species)
    not a true protein
  7. 964938Species Human (Homo sapiens) [TaxId:9606] [186894] (1 PDB entry)
  8. 964942Domain d1yz1d_: 1yz1 D: [124267]
    automated match to d1y41a_

Details for d1yz1d_

PDB Entry: 1yz1 (more details), 2 Å

PDB Description: crystal structure of human translationally controlled tumour associated protein
PDB Compounds: (D:) translationally controlled tumor protein

SCOPe Domain Sequences for d1yz1d_:

Sequence, based on SEQRES records: (download)

>d1yz1d_ b.88.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efmiiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpe
gegtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtga
aeqikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc

Sequence, based on observed residues (ATOM records): (download)

>d1yz1d_ b.88.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efmiiyrdlishdemfsdiykireiadglclevegkmvsrgvdivmnhhlqetsftkeay
kkyikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenmnpdgmval
ldyredgvtpymiffkdglemekc

SCOPe Domain Coordinates for d1yz1d_:

Click to download the PDB-style file with coordinates for d1yz1d_.
(The format of our PDB-style files is described here.)

Timeline for d1yz1d_: