Lineage for d1yz1d2 (1yz1 D:1-172)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2818899Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2818900Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 2818910Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
    contains an insertion of alpha helical hairpin; lacks zinc-binding site
    automatically mapped to Pfam PF00838
  6. 2818932Protein automated matches [190167] (2 species)
    not a true protein
  7. 2818933Species Human (Homo sapiens) [TaxId:9606] [186894] (2 PDB entries)
  8. 2818937Domain d1yz1d2: 1yz1 D:1-172 [124267]
    Other proteins in same PDB: d1yz1a3, d1yz1b3, d1yz1c3, d1yz1d3
    automated match to d1y41a_

Details for d1yz1d2

PDB Entry: 1yz1 (more details), 2 Å

PDB Description: crystal structure of human translationally controlled tumour associated protein
PDB Compounds: (D:) translationally controlled tumor protein

SCOPe Domain Sequences for d1yz1d2:

Sequence, based on SEQRES records: (download)

>d1yz1d2 b.88.1.2 (D:1-172) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc

Sequence, based on observed residues (ATOM records): (download)

>d1yz1d2 b.88.1.2 (D:1-172) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdemfsdiykireiadglclevegkmvsrgvdivmnhhlqetsftkeaykk
yikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenmnpdgmvalld
yredgvtpymiffkdglemekc

SCOPe Domain Coordinates for d1yz1d2:

Click to download the PDB-style file with coordinates for d1yz1d2.
(The format of our PDB-style files is described here.)

Timeline for d1yz1d2: