![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
![]() | Superfamily b.88.1: Mss4-like [51316] (5 families) ![]() duplication: tandem repeat of two similar structural motifs |
![]() | Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins) contains an insertion of alpha helical hairpin; lacks zinc-binding site automatically mapped to Pfam PF00838 |
![]() | Protein automated matches [190167] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186894] (2 PDB entries) |
![]() | Domain d1yz1c2: 1yz1 C:1-172 [124266] Other proteins in same PDB: d1yz1a3, d1yz1b3, d1yz1c3, d1yz1d3 automated match to d1y41a_ |
PDB Entry: 1yz1 (more details), 2 Å
SCOPe Domain Sequences for d1yz1c2:
Sequence, based on SEQRES records: (download)
>d1yz1c2 b.88.1.2 (C:1-172) automated matches {Human (Homo sapiens) [TaxId: 9606]} miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc
>d1yz1c2 b.88.1.2 (C:1-172) automated matches {Human (Homo sapiens) [TaxId: 9606]} miiyrdlishdemfsdiykireiadglclevegkmvsitgvdivmnhhlqetsftkeayk kyikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenmnpdgmvall dyredgvtpymiffkdglemekc
Timeline for d1yz1c2: