SCOPe 2.08: Domain d1yz1b2: 1yz1 B:1-172

Lineage for d1yz1b2 (1yz1 B:1-172)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (5 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
   contains an insertion of alpha helical hairpin; lacks zinc-binding site
   automatically mapped to Pfam PF00838

6. Protein automated matches [190167] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186894] (2 PDB entries)

8. Domain d1yz1b2: 1yz1 B:1-172 [124265]
   Other proteins in same PDB: d1yz1a3, d1yz1b3, d1yz1c3, d1yz1d3
   automated match to d1y41a_

Details for d1yz1b2

PDB Entry: 1yz1, 2 Å

PDB Description: crystal structure of human translationally controlled tumour associated protein

PDB Compounds: (B:) translationally controlled tumor protein

SCOPe Domain Sequences for d1yz1b2:

Sequence, based on SEQRES records:

>d1yz1b2 b.88.1.2 (B:1-172) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc

Sequence, based on observed residues (ATOM records):

>d1yz1b2 b.88.1.2 (B:1-172) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdemfsdiykireiadglclevegkmvsrtgvdivmnhhlqetsftkeayk
kyikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenmnpdgmvall
dyredgvtpymiffkdglemekc

Timeline for d1yz1b2:

• d1yz1b2 first appeared in SCOP 1.73, called d1yz1b1
  
• d1yz1b2 appears in SCOPe 2.07