Lineage for d1yywd2 (1yyw D:151-220)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722458Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 722459Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 722460Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
    Pfam PF00035
  6. 722486Protein RNase III, C-terminal domain [54776] (3 species)
  7. 722487Species Aquifex aeolicus [TaxId:63363] [102927] (6 PDB entries)
  8. 722500Domain d1yywd2: 1yyw D:151-220 [124263]
    Other proteins in same PDB: d1yywa1, d1yywb1, d1yywc1, d1yywd1
    automatically matched to d1rc7a2

Details for d1yywd2

PDB Entry: 1yyw (more details), 2.8 Å

PDB Description: Crystal structure of RNase III from Aquifex aeolicus complexed with double stranded RNA at 2.8-Angstrom Resolution
PDB Compounds: (D:) Ribonuclease III

SCOP Domain Sequences for d1yywd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yywd2 d.50.1.1 (D:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

SCOP Domain Coordinates for d1yywd2:

Click to download the PDB-style file with coordinates for d1yywd2.
(The format of our PDB-style files is described here.)

Timeline for d1yywd2: