SCOP 1.73: Domain d1yywc2: 1yyw C:151-219

Lineage for d1yywc2 (1yyw C:151-219)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
   Pfam PF00035

6. Protein RNase III, C-terminal domain [54776] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [102927] (6 PDB entries)

8. Domain d1yywc2: 1yyw C:151-219 [124261]
   Other proteins in same PDB: d1yywa1, d1yywb1, d1yywc1, d1yywd1
   automatically matched to d1rc7a2

Details for d1yywc2

PDB Entry: 1yyw, 2.8 Å

PDB Description: Crystal structure of RNase III from Aquifex aeolicus complexed with double stranded RNA at 2.8-Angstrom Resolution

PDB Compounds: (C:) Ribonuclease III

SCOP Domain Sequences for d1yywc2:

Sequence; same for both SEQRES and ATOM records:

>d1yywc2 d.50.1.1 (C:151-219) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllee

Timeline for d1yywc2:

• d1yywc2 is new in SCOP 1.73
  
• d1yywc2 appears in SCOP 1.75
  
• d1yywc2 appears in the current release, SCOPe 2.08