Lineage for d1yywa1 (1yyw A:2-150)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751862Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1751863Superfamily a.149.1: RNase III domain-like [69065] (3 families) (S)
  5. 1751864Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam PF00636
  6. 1751868Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 1751869Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)
  8. 1751895Domain d1yywa1: 1yyw A:2-150 [124256]
    Other proteins in same PDB: d1yywa2, d1yywb2, d1yywc2, d1yywd2
    automated match to d1rc7a1
    protein/RNA complex

Details for d1yywa1

PDB Entry: 1yyw (more details), 2.8 Å

PDB Description: Crystal structure of RNase III from Aquifex aeolicus complexed with double stranded RNA at 2.8-Angstrom Resolution
PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d1yywa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yywa1 a.149.1.1 (A:2-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg
rdanftrelfyklfkedilsaikegrvkk

SCOPe Domain Coordinates for d1yywa1:

Click to download the PDB-style file with coordinates for d1yywa1.
(The format of our PDB-style files is described here.)

Timeline for d1yywa1: