SCOPe 2.01: Domain d1yyvb_: 1yyv B:

Lineage for d1yyvb_ (1yyv B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.69: HxlR-like [140304] (6 proteins)
   Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)

6. Protein Putative transcriptional regulator YtfH [140311] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [140312] (1 PDB entry)
   Uniprot Q7CP90 9-122

8. Domain d1yyvb_: 1yyv B: [124255]
   automated match to d1yyva1
   complexed with cl

Details for d1yyvb_

PDB Entry: 1yyv, 2.35 Å

PDB Description: Putative transcriptional regulator ytfH from Salmonella typhimurium

PDB Compounds: (B:) Putative transcriptional regulator

SCOPe Domain Sequences for d1yyvb_:

Sequence; same for both SEQRES and ATOM records:

>d1yyvb_ a.4.5.69 (B:) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]}
egnlfaeqcpsrevlkhvtsrwgvlilvalrdgthrfsdlrrkmggvsekmlaqslqale
qdgflnrvsypvvpphveysltplgeqvsdkvaaladwielnlpqvlaqrer

Timeline for d1yyvb_:

• d1yyvb_ first appeared in SCOP 1.73, called d1yyvb1
  
• d1yyvb_ was called d1yyvb1 in SCOP 1.75
  
• d1yyvb_ appears in SCOPe 2.02
  
• d1yyvb_ appears in the current release, SCOPe 2.08