Lineage for d1yyvb1 (1yyv B:12-122)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635928Family a.4.5.69: HxlR-like [140304] (4 proteins)
    Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (scop_fa 46801)
  6. 635941Protein Putative transcriptional regulator YtfH [140311] (1 species)
  7. 635942Species Salmonella typhimurium [TaxId:90371] [140312] (1 PDB entry)
  8. 635944Domain d1yyvb1: 1yyv B:12-122 [124255]
    automatically matched to 1YYV A:9-122
    complexed with cl, mly

Details for d1yyvb1

PDB Entry: 1yyv (more details), 2.35 Å

PDB Description: Putative transcriptional regulator ytfH from Salmonella typhimurium
PDB Compounds: (B:) Putative transcriptional regulator

SCOP Domain Sequences for d1yyvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyvb1 a.4.5.69 (B:12-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 602]}
egnlfaeqcpsrevlkhvtsrwgvlilvalrdgthrfsdlrrkmggvsekmlaqslqale
qdgflnrvsypvvpphveysltplgeqvsdkvaaladwielnlpqvlaqre

SCOP Domain Coordinates for d1yyvb1:

Click to download the PDB-style file with coordinates for d1yyvb1.
(The format of our PDB-style files is described here.)

Timeline for d1yyvb1: