![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.69: HxlR-like [140304] (4 proteins) Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (scop_fa 46801) |
![]() | Protein Putative transcriptional regulator YtfH [140311] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [140312] (1 PDB entry) |
![]() | Domain d1yyvb1: 1yyv B:12-122 [124255] automatically matched to 1YYV A:9-122 complexed with cl, mly |
PDB Entry: 1yyv (more details), 2.35 Å
SCOP Domain Sequences for d1yyvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yyvb1 a.4.5.69 (B:12-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 602]} egnlfaeqcpsrevlkhvtsrwgvlilvalrdgthrfsdlrrkmggvsekmlaqslqale qdgflnrvsypvvpphveysltplgeqvsdkvaaladwielnlpqvlaqre
Timeline for d1yyvb1: