Lineage for d1yyvb_ (1yyv B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694402Family a.4.5.69: HxlR-like [140304] (6 proteins)
    Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)
  6. 2694417Protein Putative transcriptional regulator YtfH [140311] (1 species)
  7. 2694418Species Salmonella typhimurium [TaxId:90371] [140312] (1 PDB entry)
    Uniprot Q7CP90 9-122
  8. 2694420Domain d1yyvb_: 1yyv B: [124255]
    automated match to d1yyva1
    complexed with cl

Details for d1yyvb_

PDB Entry: 1yyv (more details), 2.35 Å

PDB Description: Putative transcriptional regulator ytfH from Salmonella typhimurium
PDB Compounds: (B:) Putative transcriptional regulator

SCOPe Domain Sequences for d1yyvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyvb_ a.4.5.69 (B:) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]}
egnlfaeqcpsrevlkhvtsrwgvlilvalrdgthrfsdlrrkmggvsekmlaqslqale
qdgflnrvsypvvpphveysltplgeqvsdkvaaladwielnlpqvlaqrer

SCOPe Domain Coordinates for d1yyvb_:

Click to download the PDB-style file with coordinates for d1yyvb_.
(The format of our PDB-style files is described here.)

Timeline for d1yyvb_: