SCOP 1.75: Domain d1yyva1: 1yyv A:9-122

Lineage for d1yyva1 (1yyv A:9-122)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.69: HxlR-like [140304] (5 proteins)
   Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family ((46801))

6. Protein Putative transcriptional regulator YtfH [140311] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [140312] (1 PDB entry)
   Uniprot Q7CP90 9-122

8. Domain d1yyva1: 1yyv A:9-122 [124254]
   complexed with cl, mly

Details for d1yyva1

PDB Entry: 1yyv, 2.35 Å

PDB Description: Putative transcriptional regulator ytfH from Salmonella typhimurium

PDB Compounds: (A:) Putative transcriptional regulator

SCOP Domain Sequences for d1yyva1:

Sequence; same for both SEQRES and ATOM records:

>d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]}
qlregnlfaeqcpsrevlkhvtsrwgvlilvalrdgthrfsdlrrkmggvsekmlaqslq
aleqdgflnrvsypvvpphveysltplgeqvsdkvaaladwielnlpqvlaqre

Timeline for d1yyva1:

• d1yyva1 first appeared in SCOP 1.73
  
• d1yyva1 appears in SCOPe 2.01
  
• d1yyva1 appears in the current release, SCOPe 2.08