Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.69: HxlR-like [140304] (6 proteins) Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801) |
Protein Putative transcriptional regulator YtfH [140311] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [140312] (1 PDB entry) Uniprot Q7CP90 9-122 |
Domain d1yyva1: 1yyv A:9-122 [124254] complexed with cl |
PDB Entry: 1yyv (more details), 2.35 Å
SCOPe Domain Sequences for d1yyva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]} qlregnlfaeqcpsrevlkhvtsrwgvlilvalrdgthrfsdlrrkmggvsekmlaqslq aleqdgflnrvsypvvpphveysltplgeqvsdkvaaladwielnlpqvlaqre
Timeline for d1yyva1: