SCOP 1.75: Domain d1yyub1: 1yyu B:1-354

Lineage for d1yyub1 (1yyu B:1-354)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (5 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.5: Trichodiene synthase [69113] (1 protein)

6. Protein Trichodiene synthase [69114] (1 species)

7. Species Fusarium sporotrichioides [TaxId:5514] [69115] (8 PDB entries)

8. Domain d1yyub1: 1yyu B:1-354 [124253]
   automatically matched to d1kiya_
   complexed with edo, mg, pop, raz, saz; mutant

Details for d1yyub1

PDB Entry: 1yyu, 2.95 Å

PDB Description: d100e trichodiene synthase: complex with mg, pyrophosphate, and (4s)- 7-azabisabolene

PDB Compounds: (B:) trichodiene synthase

SCOP Domain Sequences for d1yyub1:

Sequence; same for both SEQRES and ATOM records:

>d1yyub1 a.128.1.5 (B:1-354) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

Timeline for d1yyub1:

• d1yyub1 first appeared in SCOP 1.73
  
• d1yyub1 appears in SCOPe 2.01
  
• d1yyub1 appears in the current release, SCOPe 2.08, called d1yyub_