SCOPe 2.08: Domain d1yyub_: 1yyu B:

Lineage for d1yyub_ (1yyu B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
   automatically mapped to Pfam PF06330

6. Protein Trichodiene synthase [69114] (1 species)

7. Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries)

8. Domain d1yyub_: 1yyu B: [124253]
   automated match to d1kiya_
   complexed with edo, mg, pop, raz, saz

Details for d1yyub_

PDB Entry: 1yyu, 2.95 Å

PDB Description: d100e trichodiene synthase: complex with mg, pyrophosphate, and (4s)- 7-azabisabolene

PDB Compounds: (B:) trichodiene synthase

SCOPe Domain Sequences for d1yyub_:

Sequence; same for both SEQRES and ATOM records:

>d1yyub_ a.128.1.5 (B:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

Timeline for d1yyub_:

• d1yyub_ first appeared in SCOP 1.73, called d1yyub1
  
• d1yyub_ appears in SCOPe 2.07