Lineage for d1yyub_ (1yyu B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010861Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
    automatically mapped to Pfam PF06330
  6. 2010862Protein Trichodiene synthase [69114] (1 species)
  7. 2010863Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries)
  8. 2010901Domain d1yyub_: 1yyu B: [124253]
    automated match to d1kiya_
    complexed with edo, mg, pop, raz, saz

Details for d1yyub_

PDB Entry: 1yyu (more details), 2.95 Å

PDB Description: D100E Trichodiene Synthase: Complex With Mg, Pyrophosphate, and (4S)-7-azabisabolene
PDB Compounds: (B:) trichodiene synthase

SCOPe Domain Sequences for d1yyub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyub_ a.128.1.5 (B:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

SCOPe Domain Coordinates for d1yyub_:

Click to download the PDB-style file with coordinates for d1yyub_.
(The format of our PDB-style files is described here.)

Timeline for d1yyub_: