Lineage for d1yyua_ (1yyu A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
    automatically mapped to Pfam PF06330
  6. Protein Trichodiene synthase [69114] (1 species)
  7. Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries)
  8. Domain d1yyua_: 1yyu A: [124252]
    automated match to d1kiya_
    complexed with edo, mg, pop, raz, saz

Details for d1yyua_

PDB Entry: 1yyu (more details), 2.95 Å

PDB Description: D100E Trichodiene Synthase: Complex With Mg, Pyrophosphate, and (4S)-7-azabisabolene
PDB Compounds: (A:) trichodiene synthase

SCOPe Domain Sequences for d1yyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyua_ a.128.1.5 (A:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

SCOPe Domain Coordinates for d1yyua_ are not available.

Timeline for d1yyua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yyub_