Lineage for d1yypa1 (1yyp A:9-135)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. Protein UL44 [111176] (2 species)
  7. Species Human cytomegalovirus, HHV-5 [TaxId:10359] [111177] (2 PDB entries)
    Uniprot P16790 1-290
  8. Domain d1yypa1: 1yyp A:9-135 [124248]
    automated match to d1t6la1
    complexed with edo, so4

Details for d1yypa1

PDB Entry: 1yyp (more details), 2.5 Å

PDB Description: crystal structure of cytomegalovirus ul44 bound to c-terminal peptide from cmv ul54
PDB Compounds: (A:) DNA polymerase processivity factor

SCOPe Domain Sequences for d1yypa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yypa1 d.131.1.2 (A:9-135) UL44 {Human cytomegalovirus, HHV-5 [TaxId: 10359]}
epptlalrlkpyktaiqqlrsviralkenttvtflptpslilqtvrshcvskitfnsscl
yitdksfqpktinnstpllgnfmyltsskdltkfyvqdisdlsakismcapdfnmefssa
cvhgqdi

SCOPe Domain Coordinates for d1yypa1 are not available.

Timeline for d1yypa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yypa2