Lineage for d1yyob1 (1yyo B:2-150)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013374Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2013375Superfamily a.149.1: RNase III domain-like [69065] (3 families) (S)
  5. 2013376Family a.149.1.1: RNase III catalytic domain-like [69066] (2 protein domains)
    Pfam PF00636
  6. 2013380Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 2013381Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)
  8. 2013404Domain d1yyob1: 1yyo B:2-150 [124246]
    Other proteins in same PDB: d1yyoa2, d1yyob2
    automated match to d1rc7a1
    protein/RNA complex; complexed with trs; mutant

Details for d1yyob1

PDB Entry: 1yyo (more details), 2.9 Å

PDB Description: Crystal structure of RNase III mutant E110K from Aquifex aeolicus complexed with double-stranded RNA at 2.9-Angstrom Resolution
PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d1yyob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyob1 a.149.1.1 (B:2-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfkalwaavyidsg
rdanftrelfyklfkedilsaikegrvkk

SCOPe Domain Coordinates for d1yyob1:

Click to download the PDB-style file with coordinates for d1yyob1.
(The format of our PDB-style files is described here.)

Timeline for d1yyob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yyob2