SCOPe 2.05: Domain d1yyoa2: 1yyo A:151-220

Lineage for d1yyoa2 (1yyo A:151-220)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
   Pfam PF00035

6. Protein RNase III, C-terminal domain [54776] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries)

8. Domain d1yyoa2: 1yyo A:151-220 [124245]
   Other proteins in same PDB: d1yyoa1, d1yyob1
   automated match to d2nugb2
   protein/RNA complex; complexed with trs; mutant

Details for d1yyoa2

PDB Entry: 1yyo, 2.9 Å

PDB Description: crystal structure of rnase iii mutant e110k from aquifex aeolicus complexed with double-stranded rna at 2.9-angstrom resolution

PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d1yyoa2:

Sequence; same for both SEQRES and ATOM records:

>d1yyoa2 d.50.1.1 (A:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

Timeline for d1yyoa2:

• d1yyoa2 first appeared in SCOP 1.73
  
• d1yyoa2 appears in SCOPe 2.04
  
• d1yyoa2 appears in SCOPe 2.06
  
• d1yyoa2 appears in the current release, SCOPe 2.08