SCOP 1.75: Domain d1yyoa1: 1yyo A:1-150

Lineage for d1yyoa1 (1yyo A:1-150)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.149: RNase III domain-like [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III domain-like [69065] (2 families)

5. Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
   Pfam PF00636

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)

8. Domain d1yyoa1: 1yyo A:1-150 [124244]
   Other proteins in same PDB: d1yyoa2, d1yyob2
   automatically matched to d1rc7a1
   complexed with trs; mutant

Details for d1yyoa1

PDB Entry: 1yyo, 2.9 Å

PDB Description: crystal structure of rnase iii mutant e110k from aquifex aeolicus complexed with double-stranded rna at 2.9-angstrom resolution

PDB Compounds: (A:) Ribonuclease III

SCOP Domain Sequences for d1yyoa1:

Sequence; same for both SEQRES and ATOM records:

>d1yyoa1 a.149.1.1 (A:1-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfkalwaavyids
grdanftrelfyklfkedilsaikegrvkk

Timeline for d1yyoa1:

• d1yyoa1 first appeared in SCOP 1.73
  
• d1yyoa1 appears in SCOPe 2.01
  
• d1yyoa1 appears in the current release, SCOPe 2.08