Lineage for d1yyna1 (1yyn A:875-1110)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663960Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins)
  6. 663982Protein Tetanus neurotoxin [49957] (1 species)
  7. 663983Species Clostridium tetani [TaxId:1513] [49958] (10 PDB entries)
  8. 663990Domain d1yyna1: 1yyn A:875-1110 [124242]
    Other proteins in same PDB: d1yyna2
    automatically matched to d1a8d_1
    complexed with gla, glc, sia

Details for d1yyna1

PDB Entry: 1yyn (more details), 2.3 Å

PDB Description: a common binding site for disialyllactose and a tri-peptide in the c- fragment of tetanus neurotoxin
PDB Compounds: (A:) Tetanus toxin

SCOP Domain Sequences for d1yyna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyna1 b.29.1.6 (A:875-1110) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsyls

SCOP Domain Coordinates for d1yyna1:

Click to download the PDB-style file with coordinates for d1yyna1.
(The format of our PDB-style files is described here.)

Timeline for d1yyna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yyna2