Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) SQ NA # humanized antibody Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region SQ NA # engineered antibody including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
Domain d1yymr2: 1yym R:1114-1214 [124241] Other proteins in same PDB: d1yymg1, d1yymh1, d1yyml1, d1yyml2, d1yymm1, d1yymp1, d1yymq1, d1yymq2, d1yymr1, d1yyms1 automatically matched to d1ngzb2 complexed with edo, ipa, mpt, nag, ndg, vlm; mutant |
PDB Entry: 1yym (more details), 2.2 Å
SCOP Domain Sequences for d1yymr2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yymr2 b.1.1.2 (R:1114-1214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1yymr2: