SCOP 1.73: Domain d1yymr2: 1yym R:1114-1214

Lineage for d1yymr2 (1yym R:1114-1214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1yymr2: 1yym R:1114-1214 [124241]
   Other proteins in same PDB: d1yymg1, d1yymh1, d1yyml1, d1yyml2, d1yymp1, d1yymq1, d1yymq2, d1yymr1
   automatically matched to d1ngzb2
   complexed with edo, ipa, mpt, nag, ndg, vlm; mutant

Details for d1yymr2

PDB Entry: 1yym, 2.2 Å

PDB Description: crystal structure of f23, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b

PDB Compounds: (R:) Antibody 17B Heavy chain

SCOP Domain Sequences for d1yymr2:

Sequence; same for both SEQRES and ATOM records:

>d1yymr2 b.1.1.2 (R:1114-1214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1yymr2:

• d1yymr2 is new in SCOP 1.73
  
• d1yymr2 appears in SCOP 1.75
  
• d1yymr2 appears in the current release, SCOPe 2.08