Lineage for d1yyml2 (1yym L:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2748803Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2748866Domain d1yyml2: 1yym L:108-212 [124236]
    Other proteins in same PDB: d1yymg_, d1yymh1, d1yymh2, d1yyml1, d1yymm1, d1yymp_, d1yymq1, d1yymr1, d1yymr2, d1yyms1
    automatically matched to d1g9ml2
    complexed with edo, ipa, nag

Details for d1yyml2

PDB Entry: 1yym (more details), 2.2 Å

PDB Description: crystal structure of f23, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (L:) Antibody 17B Light chain

SCOPe Domain Sequences for d1yyml2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyml2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d1yyml2:

Click to download the PDB-style file with coordinates for d1yyml2.
(The format of our PDB-style files is described here.)

Timeline for d1yyml2: