Lineage for d1yyml1 (1yym L:1-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782793Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)
  8. 782808Domain d1yyml1: 1yym L:1-107 [124235]
    Other proteins in same PDB: d1yymg1, d1yymh1, d1yymh2, d1yyml2, d1yymm1, d1yymp1, d1yymq2, d1yymr1, d1yymr2, d1yyms1
    automatically matched to d1g9ml1
    complexed with edo, ipa, mpt, nag, ndg, vlm; mutant

Details for d1yyml1

PDB Entry: 1yym (more details), 2.2 Å

PDB Description: crystal structure of f23, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (L:) Antibody 17B Light chain

SCOP Domain Sequences for d1yyml1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyml1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleik

SCOP Domain Coordinates for d1yyml1:

Click to download the PDB-style file with coordinates for d1yyml1.
(The format of our PDB-style files is described here.)

Timeline for d1yyml1: