Lineage for d1yymh2 (1yym H:114-214)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2022294Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 2022298Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2022366Domain d1yymh2: 1yym H:114-214 [124234]
    Other proteins in same PDB: d1yymg_, d1yymh1, d1yyml1, d1yyml2, d1yymm1, d1yymp_, d1yymq1, d1yymq2, d1yymr1, d1yyms1
    automatically matched to d1ngzb2
    complexed with edo, ipa, nag, ndg

Details for d1yymh2

PDB Entry: 1yym (more details), 2.2 Å

PDB Description: crystal structure of F23, a scorpion-toxin mimic of CD4, in complex with HIV-1 YU2 gp120 envelope glycoprotein and anti-HIV-1 antibody 17b
PDB Compounds: (H:) Antibody 17B Heavy chain

SCOPe Domain Sequences for d1yymh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yymh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d1yymh2:

Click to download the PDB-style file with coordinates for d1yymh2.
(The format of our PDB-style files is described here.)

Timeline for d1yymh2: