SCOPe 2.08: Domain d1yymh1: 1yym H:1-113

Lineage for d1yymh1 (1yym H:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)

8. Domain d1yymh1: 1yym H:1-113 [124233]
   Other proteins in same PDB: d1yymg_, d1yymh2, d1yyml1, d1yyml2, d1yymm1, d1yymp_, d1yymq1, d1yymq2, d1yymr2, d1yyms1
   automatically matched to d1rz8b1
   complexed with edo, ipa, nag

Details for d1yymh1

PDB Entry: 1yym, 2.2 Å

PDB Description: crystal structure of f23, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b

PDB Compounds: (H:) Antibody 17B Heavy chain

SCOPe Domain Sequences for d1yymh1:

Sequence; same for both SEQRES and ATOM records:

>d1yymh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
gtlvtvss

Timeline for d1yymh1:

• d1yymh1 first appeared in SCOP 1.73
  
• d1yymh1 appears in SCOPe 2.07